Recombinant Human coronavirus SARS-CoV-2 nucleocapsid protein (His tag)

SKU: N/A Categories: ,

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Tags: His tag C-Terminus
  • Suitable for: Sandwich ELISA, SDS-PAGE

Overview

Product name

Recombinant Human coronavirus SARS-CoV-2 nucleocapsid protein (His tag)
See all SARS-CoV-2 nucleocapsid protein proteins and peptides

Purity

> 95 % SDS-PAGE.

Expression system

Escherichia coli

Accession

Protein length

Full length protein

Animal free

No

Nature

Recombinant

Species

Human coronavirus

Sequence

MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTA SWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGK MKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPG SSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKS AAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQV ILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADL DDFSKQLQQSMSSADSTQAGSGGSGGGSHHHHHH

Predicted molecular weight

47 kDa including tags

Actual molecular weight

47 kDa including tags

Amino acids

1 to 419

Tags

His tag C-Terminus

Additional sequence information

Sequence Strain: Wuhan-Hu-1

Properties

Our Abpromise guarantee covers the use of ab279288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Applications

Sandwich ELISA

SDS-PAGE

Form

Liquid

Concentration

Batch dependent within range: 100 µg at 0.93 – 1.75 mg/ml

Protocols