Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active)

SKU: N/A Categories: ,

Key features and details

  • Expression system: CHO cells
  • Purity: > 90% SDS-PAGE
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: ELISA, Flow Cyt, SDS-PAGE

Overview

Product name

Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active)
See all SARS-CoV-2 Spike Glycoprotein RBD proteins and peptides

Biological activity

Binding ability measured in a functional ELISA. Immobilized Human ACE2 protein at 2 ug/ml (100 ul/well) can bind to ab273065.

Purity

> 90 % SDS-PAGE.
Purity is lot specific. Please contact our technical Support team for details.

Expression system

CHO cells

Accession

MN908947

Protein length

Protein fragment

Animal free

No

Nature

Recombinant

Species

Human coronavirus

Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVL YNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDI STEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL HAPATVCGPKKSTNLVKNKCVNFGSGGGSGGHHHHHH

Actual molecular weight

39 kDa including tags

Amino acids

319 to 541

Tags

His tag C-Terminus

Properties

Applications

ELISA

Flow Cytometry

SDS-PAGE

Form

Liquid
Concentration
  • 50 µg at 1 mg/ml

Protocols