Native Human IgM protein

SKU: N/A Categories: ,

Key features and details

  • Expression system: Native
  • Purity: > 95% SDS-PAGE
  • Suitable for: SDS-PAGE

Overview

Product name

Native Human IgM protein
See all IgM proteins and peptides

Purity

> 95 % SDS-PAGE.

Expression system

Native

Accession

P01871

Protein length

Full length protein

Animal free

No

Nature

Native

Species

Human

Sequence

GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDI SSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKN VPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLR EGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVD HRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLT TYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDDWNSGER FTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATIT CLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTV SEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTLYNVSLVMSDTAG TCY

Predicted molecular weight

950 kDa

Properties

Applications

SDS-PAGE

Form

Liquid

Additional notes

ab91117 is IgM purified from normal plasma. For IgM purified from myeloma plasma, please refer to ab90348.

Protein Determination: Extinction Coefficient (E) 0.1% at 280nm, 1cm pathway = 1.18. Prepared from plasma shown to be non reactive for HBsAg, anti-HCV, anti-HBc, and negative for anti-HIV 1 & 2 by FDA approved tests.

Concentration
  • Batch dependent within range: 1 mg at 1.33 – 1.98 mg/ml

Protocols